PPIRE12918
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | biotin-binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GyGlanvdessG |
|---|---|
| Peptide_Sequence | GyGlanvdessG |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1168.18 |
|---|---|
| Aliphatic_Index | 65.00000 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.08333 |
| Charge_at_pH_7 | -2.00064 |
| Isoelectric_Point | 3.55007 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 19 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 561.80000 |
| X_logP_energy | -8.50490 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Stepwise Evolution Improves Identification of Diverse Peptides Binding to a Protein Target. |
| Release_Year | 2017 |
| PMID | 28935886 |
| DOI | 10.1038/s41598-017-12440-1 |