PPIRE12957
Target Protein Information
| Protein_Name | Interstitial collagenase |
|---|---|
| Protein_Sequence | MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
| Organism_Source | Homo sapiens |
| Functional_Classification | matrix metalloproteinases |
| Cellular_Localization | Extracellular |
| Gene_Names | MMP1 |
| UniProt_ID | P03956 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LamA2091-2108 |
|---|---|
| Peptide_Sequence | CSRARKQAASIKVAVSADR |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2017.34 |
|---|---|
| Aliphatic_Index | 77.36842 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.68421 |
| Charge_at_pH_7 | 3.93586 |
| Isoelectric_Point | 11.55108 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 31 |
| Number_of_Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 965.94000 |
| X_logP_energy | -13.72299 |
Interaction Information
| Affinity | IC50=3 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Steady-state redox behavior of cytochrome c, cytochrome a, and CuA of cytochrome c oxidase in intact rat liver mitochondria. |
| Release_Year | 1991 |
| PMID | 1846562 |
| DOI | 10.1021/bi00218a010 |