PPIRE12969
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein |
|---|---|
| Protein_Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
| Organism_Source | Homo sapiens |
| Functional_Classification | LC3/GABARAP family |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAP |
| UniProt_ID | O95166 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Human UBA5 LIR/UFIM peptide |
|---|---|
| Peptide_Sequence | EIIHEDNEWGIELVSEVSE |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)CC)[C@@H](C)CC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2227.37 |
|---|---|
| Aliphatic_Index | 112.63158 |
| Aromaticity | 0.05263 |
| Average_Rotatable_Bonds | 3.94737 |
| Charge_at_pH_7 | -6.90001 |
| Isoelectric_Point | 3.52034 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 31 |
| Number_of_Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 976.24000 |
| X_logP_energy | -7.53420 |
Interaction Information
| Affinity | KD=14.4 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and Functional Analysis of a Novel Interaction Motif within UFM1-activating Enzyme 5 (UBA5)Required for Binding to Ubiquitin-like Proteins and Ufmylation. |
| Release_Year | 2016 |
| PMID | 26929408 |
| DOI | 10.1074/jbc.M116.715474 |