PPIRE13003
Target Protein Information
| Protein_Name | Ribonuclease pancreatic |
|---|---|
| Protein_Sequence | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Organism_Source | Bos taurus |
| Functional_Classification | ribonucleases |
| Cellular_Localization | Extracellular |
| Gene_Names | RNASE1 |
| UniProt_ID | P61823 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S15(M13Nle) |
|---|---|
| Peptide_Sequence | KVFGRCELAAAXRHGLDNY |
| Peptide_Length | 19 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | X12=norleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2077.35 |
|---|---|
| Aliphatic_Index | 72.10526 |
| Aromaticity | 0.10526 |
| Average_Rotatable_Bonds | 3.57895 |
| Charge_at_pH_7 | 1.02799 |
| Isoelectric_Point | 8.53040 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 29 |
| Number_of_Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 903.54000 |
| X_logP_energy | -9.21616 |
Interaction Information
| Affinity | KD=1.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Osmolytes stabilize ribonuclease S by stabilizing its fragments S protein and S peptide to compact folding-competent states. |
| Release_Year | 2001 |
| PMID | 11373282 |
| DOI | 10.1074/jbc.M101906200 |