PPIRE13101
Target Protein Information
| Protein_Name | GTPase KRas |
|---|---|
| Protein_Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM |
| Organism_Source | Homo sapiens |
| Functional_Classification | GTPases |
| Cellular_Localization | Plasma membrane |
| Gene_Names | KRAS |
| UniProt_ID | P01116 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | KRpep-2d |
|---|---|
| Peptide_Sequence | RRRRCPLYISYDPVCRRRR |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C5<->C15; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2522.00 |
|---|---|
| Aliphatic_Index | 56.31579 |
| Aromaticity | 0.10526 |
| Average_Rotatable_Bonds | 4.26316 |
| Charge_at_pH_7 | 6.87275 |
| Isoelectric_Point | 12.02986 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 34 |
| Number_of_Hydrogen_Bond_Donors | 48 |
| Topological_Polar_Surface_Area | 1162.73000 |
| X_logP_energy | -11.78534 |
Interaction Information
| Affinity | KD=8.9 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 5XCO |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal Structure of a Human K-Ras G12D Mutant in Complex with GDP and the Cyclic Inhibitory Peptide KRpep-2d. |
| Release_Year | 2017 |
| PMID | 28740607 |
| DOI | 10.1021/acsmedchemlett.7b00128 |