PPIRE13125
Target Protein Information
| Protein_Name | Histone H3.1 |
|---|---|
| Protein_Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Organism_Source | Homo sapiens |
| Functional_Classification | histones |
| Cellular_Localization | Nucleus |
| Gene_Names | H3C1 |
| UniProt_ID | P68431 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K9me3 peptide |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAPGYCD |
| Peptide_Length | 20 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2096.35 |
|---|---|
| Aliphatic_Index | 15.00000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 3.93471 |
| Isoelectric_Point | 10.63357 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 34 |
| Number_of_Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 990.83000 |
| X_logP_energy | -15.26386 |
Interaction Information
| Affinity | KD=2 uM |
|---|---|
| Affinity_Assay | peptide immunoprecipitation assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Broad ranges of affinity and specificity of anti-histone antibodies revealed by a quantitative peptide immunoprecipitation assay. |
| Release_Year | 2012 |
| PMID | 23041298 |
| DOI | 10.1016/j.jmb.2012.09.022 |