PPIRE13204
Target Protein Information
| Protein_Name | Tissue factor pathway inhibitor |
|---|---|
| Protein_Sequence | MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM |
| Organism_Source | Homo sapiens |
| Functional_Classification | Kunitz-type protease inhibitor |
| Cellular_Localization | Extracellular |
| Gene_Names | TFPI |
| UniProt_ID | P10646 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Compound 2 |
|---|---|
| Peptide_Sequence | FQSKGNVFVDGYFERLRAKL |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2374.73 |
|---|---|
| Aliphatic_Index | 73.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 1.99876 |
| Isoelectric_Point | 10.23977 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 31 |
| Number_of_Hydrogen_Bond_Donors | 35 |
| Topological_Polar_Surface_Area | 993.30000 |
| X_logP_energy | -7.76996 |
Interaction Information
| Affinity | KD=17.7 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Small peptides blocking inhibition of factor Xa and tissue factor-factor VIIa by tissue factor pathway inhibitor (TFPI). |
| Release_Year | 2014 |
| PMID | 24275667 |
| DOI | 10.1074/jbc.M113.533836 |