PPIRE13209
Target Protein Information
| Protein_Name | Protein S100-A10 |
|---|---|
| Protein_Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | S100 proteins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | S100A10 |
| UniProt_ID | P60903 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AHNAK(5654-5673)peptide |
|---|---|
| Peptide_Sequence | GKVTFPKMKIPSFTPSDSSG |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CN)C(C)C)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2111.44 |
|---|---|
| Aliphatic_Index | 34.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.30000 |
| Charge_at_pH_7 | 1.99755 |
| Isoelectric_Point | 10.50692 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 32 |
| Number_of_Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 826.59000 |
| X_logP_energy | -10.07600 |
Interaction Information
| Affinity | KD=30 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4FTG |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of a C-terminal AHNAK peptide in a 1:2:2 complex with S100A10 and an acetylated N-terminal peptide of annexin A2. |
| Release_Year | 2013 |
| PMID | 23275167 |
| DOI | 10.1107/S0907444912043429 |