PPIRE13233
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | DNA clamp |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p21(141-160)peptide |
|---|---|
| Peptide_Sequence | KRRQTSMTDFYHSKRRLIFS |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2557.96 |
|---|---|
| Aliphatic_Index | 39.00000 |
| Aromaticity | 0.15000 |
| Average_Rotatable_Bonds | 4.40000 |
| Charge_at_pH_7 | 5.08789 |
| Isoelectric_Point | 12.08412 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 37 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1146.31000 |
| X_logP_energy | -12.35592 |
Interaction Information
| Affinity | KD=80 nM |
|---|---|
| Affinity_Assay | not reported |
| PDB_ID | 1AXC |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and biochemical studies of human proliferating cell nuclear antigen complexes provide a rationale for cyclin association and inhibitor design. |
| Release_Year | 2005 |
| PMID | 15681588 |
| DOI | 10.1073/pnas.0406540102 |