PPIRE13394
Target Protein Information
| Protein_Name | Histone-binding protein RBBP4 |
|---|---|
| Protein_Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | histone chaperones |
| Cellular_Localization | Nucleus |
| Gene_Names | RBBP4 |
| UniProt_ID | Q09028 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Histone H3 1-21 |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAPRKQLA |
| Peptide_Length | 21 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | 5-FAM |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2254.62 |
|---|---|
| Aliphatic_Index | 37.61905 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.80952 |
| Charge_at_pH_7 | 6.99679 |
| Isoelectric_Point | 12.82564 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 35 |
| Number_of_Hydrogen_Bond_Donors | 40 |
| Topological_Polar_Surface_Area | 1093.41000 |
| X_logP_energy | -16.03949 |
Interaction Information
| Affinity | KD=0.84 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Probing the interaction between the histone methyltransferase/deacetylase subunit RBBP4/7 and the transcription factor BCL11A in epigenetic complexes. |
| Release_Year | 2017 |
| PMID | 29263092 |
| DOI | 10.1074/jbc.M117.811463 |