PPIRE13558
Target Protein Information
| Protein_Name | Urokinase plasminogen activator surface receptor |
|---|---|
| Protein_Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
| Organism_Source | Homo sapiens |
| Functional_Classification | Ly-6/uPAR family |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PLAUR |
| UniProt_ID | Q03405 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | (NAc-dD-CHA-F-dS-dR-Y-L-W-S-(cid:1)Ala)2-K-K(DOTA)-NH2 |
|---|---|
| Peptide_Sequence | dXFsrYLWSXdXFsrYLWSXKK |
| Peptide_Length | 22 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X2=N-cyclohexylalanine; X10=CID-Ala; X12=N-cyclohexylalanine; X20=CID-Ala |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2612.89 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.27273 |
| Average_Rotatable_Bonds | 3.77273 |
| Charge_at_pH_7 | 1.99658 |
| Isoelectric_Point | 9.92697 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 35 |
| Number_of_Hydrogen_Bond_Donors | 41 |
| Topological_Polar_Surface_Area | 1077.82000 |
| X_logP_energy | -9.26996 |
Interaction Information
| Affinity | IC50=240 nM |
|---|---|
| Affinity_Assay | receptor binding assay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and characterization of an (111)In-labeled peptide for the in vivo localization of human cancers expressing the urokinase-type plasminogen activator receptor (uPAR). |
| Release_Year | 2009 |
| PMID | 19354275 |
| DOI | 10.1021/bc800433y |