PPIRE13640
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 2A |
|---|---|
| Protein_Sequence | KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGLDLDDVCAEAQDGELDGLWTTITIFISLFLLSVCYSASVTLFKVKWIFSSVVELKQTISPDYRNMIGQGA |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg2a |
| UniProt_ID | P01865 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | M2e |
|---|---|
| Peptide_Sequence | MSLLTEVETPIRNEWGCRCNDSS |
| Peptide_Length | 23 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CCSC)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2640.94 |
|---|---|
| Aliphatic_Index | 63.47826 |
| Aromaticity | 0.04348 |
| Average_Rotatable_Bonds | 3.73913 |
| Charge_at_pH_7 | -2.12020 |
| Isoelectric_Point | 4.14752 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 40 |
| Number_of_Hydrogen_Bond_Donors | 43 |
| Topological_Polar_Surface_Area | 1170.85000 |
| X_logP_energy | -14.58256 |
Interaction Information
| Affinity | KD=0.4 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 4N8C |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the extracellular domain of matrix protein 2 of influenza A virus in complex with a protective monoclonal antibody. |
| Release_Year | 2015 |
| PMID | 25609808 |
| DOI | 10.1128/JVI.02576-14 |