PPIRE13680
Target Protein Information
| Protein_Name | Histone-binding protein RBBP4 |
|---|---|
| Protein_Sequence | MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromatin remodelers |
| Cellular_Localization | Nucleus |
| Gene_Names | RBBP4 |
| UniProt_ID | Q09028 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Histone H3(1-25) |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAPRKQLATKA |
| Peptide_Length | 24 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2554.98 |
|---|---|
| Aliphatic_Index | 37.08333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.79167 |
| Charge_at_pH_7 | 7.99650 |
| Isoelectric_Point | 12.83145 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 40 |
| Number_of_Hydrogen_Bond_Donors | 45 |
| Topological_Polar_Surface_Area | 1226.96000 |
| X_logP_energy | -18.05539 |
Interaction Information
| Affinity | KD=1.5 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Direct interaction between the PRDM3 and PRDM16 tumor suppressors and the NuRD chromatin remodeling complex. |
| Release_Year | 2018 |
| PMID | 30462309 |
| DOI | 10.1093/nar/gky1192 |