PPIRE13687
Target Protein Information
| Protein_Name | Voltage-dependent N-type calcium channel subunit alpha-1B |
|---|---|
| Protein_Sequence | LVTEIADTDNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALNDETSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLSNRACDPLSGLTKNECGSDFAYFYFVSFIFLCSFLMLNLFVAVI |
| Organism_Source | Gallus gallus |
| Functional_Classification | voltage-gated calcium channels; N-type |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CACNA1B |
| UniProt_ID | O73706 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | omega-conotoxin GVIA |
|---|---|
| Peptide_Sequence | ECCSDPRCAKGCGSGSSCNPYIDK |
| Peptide_Length | 24 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CS)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CS)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2480.76 |
|---|---|
| Aliphatic_Index | 20.41667 |
| Aromaticity | 0.04167 |
| Average_Rotatable_Bonds | 3.29167 |
| Charge_at_pH_7 | -0.31066 |
| Isoelectric_Point | 6.12220 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 42 |
| Number_of_Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1085.12000 |
| X_logP_energy | -17.70133 |
Interaction Information
| Affinity | KD=68 pM |
|---|---|
| Affinity_Assay | radioligand binding assay (New Binding Method) |
| PDB_ID | None |
| Type | Ion channel modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characteristics of omega-conotoxin GVI A and MVIIC binding to Cav 2.1 and Cav 2.2 channels captured by anti-Ca2+ channel peptide antibodies. |
| Release_Year | 2005 |
| PMID | 16076016 |
| DOI | 10.1007/s11064-005-2681-5 |