PPIRE13690
Target Protein Information
| Protein_Name | Voltage-dependent P/Q-type calcium channel subunit alpha-1A |
|---|---|
| Protein_Sequence | FVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIEEEDDESAITQHNNFRTFFQALMLLFRSATGEAWHEIMLSCLSGKPCDENSGIKEDECGNEFAYFYFVSFIFLCSFLMLNLFVAVI |
| Organism_Source | Gallus gallus |
| Functional_Classification | voltage-gated calcium channels; P/Q-type |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CACNA1A |
| UniProt_ID | O73705 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | omega-conotoxin MVIIC |
|---|---|
| Peptide_Sequence | GCCPDRHTCGGYEHGAIPGTSCSN |
| Peptide_Length | 24 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)CNC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)CN)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2422.62 |
|---|---|
| Aliphatic_Index | 20.41667 |
| Aromaticity | 0.04167 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -1.06673 |
| Isoelectric_Point | 6.46860 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 40 |
| Number_of_Hydrogen_Bond_Donors | 40 |
| Topological_Polar_Surface_Area | 1053.14000 |
| X_logP_energy | -17.39243 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characteristics of omega-conotoxin GVI A and MVIIC binding to Cav 2.1 and Cav 2.2 channels captured by anti-Ca2+ channel peptide antibodies. |
| Release_Year | 2005 |
| PMID | 16076016 |
| DOI | 10.1007/s11064-005-2681-5 |