PPIRE13693
Target Protein Information
| Protein_Name | Vascular endothelial growth factor A, long form |
|---|---|
| Protein_Sequence | MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Organism_Source | Homo sapiens |
| Functional_Classification | growth factors |
| Cellular_Localization | Extracellular |
| Gene_Names | VEGFA |
| UniProt_ID | P15692 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | compound 1 |
|---|---|
| Peptide_Sequence | GPGSGRGWVEICAADDYGRGPGSK |
| Peptide_Length | 24 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)CN)C(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fluorophore |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2392.59 |
|---|---|
| Aliphatic_Index | 36.66667 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.08333 |
| Charge_at_pH_7 | -0.06247 |
| Isoelectric_Point | 6.37567 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 35 |
| Number_of_Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 1053.24000 |
| X_logP_energy | -14.22076 |
Interaction Information
| Affinity | KD=6 nM |
|---|---|
| Affinity_Assay | fluorescence spectrophotometry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Construction of a more sensitive fluorescence sensing material for the detection of vascular endothelial growth factor, a biomarker for angiogenesis, prepared by combining a fluorescent peptide and a nanopillar substrate. |
| Release_Year | 2011 |
| PMID | 21388797 |
| DOI | 10.1016/j.bios.2011.02.007 |