PPIRE13856
Target Protein Information
| Protein_Name | Apoptosis regulator Bcl-2 homolog |
|---|---|
| Protein_Sequence | MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKVKQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNTASYCIFTASLIIASLAVFKICSFYM |
| Organism_Source | Fowlpox virus (strain NVSL) |
| Functional_Classification | apoptosis regulators |
| Cellular_Localization | Mitochondrion |
| Gene_Names | None |
| UniProt_ID | Q9J5G4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HS_Puma |
|---|---|
| Peptide_Sequence | EEQWAREIGAQLRRMADDLNAQYERR |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3205.51 |
|---|---|
| Aliphatic_Index | 60.38462 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 4.26923 |
| Charge_at_pH_7 | -0.99489 |
| Isoelectric_Point | 4.77279 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 44 |
| Number_of_Hydrogen_Bond_Donors | 54 |
| Topological_Polar_Surface_Area | 1532.50000 |
| X_logP_energy | -15.81015 |
Interaction Information
| Affinity | KD=24 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis of apoptosis inhibition by the fowlpox virus protein FPV039. |
| Release_Year | 2017 |
| PMID | 28411240 |
| DOI | 10.1074/jbc.M116.768879 |