PPIRE14319
Target Protein Information
| Protein_Name | Adrenocorticotropic hormone receptor |
|---|---|
| Protein_Sequence | NLIVLLAVIKNKNLQSPVYFFICSLAISDMLGSLYKILENILIMFRNMGYLKPRGSLESTADDIIDCMFVLSLLGSIFSLSVIAADRYITIFHALQYHSIVTMRRTVITLTVIWMFCTGSGITMVIFSHHIPTVLTFTSLFPLMLVFILCLYIHMFLLARSHARKISTLPRANMKGAMTLTILLGVFIFCWAPFVLHVLLMTFCPNNPYCVCYMSLFQVNGMLIMCNAVIDPFIYAFRSPEQ |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Mc2r |
| UniProt_ID | Q8CIX6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CIP |
|---|---|
| Peptide_Sequence | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
| Peptide_Length | 32 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3659.17 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.12500 |
| Average_Rotatable_Bonds | 3.65625 |
| Charge_at_pH_7 | 2.00349 |
| Isoelectric_Point | 10.02184 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 48 |
| Number_of_Hydrogen_Bond_Donors | 51 |
| Topological_Polar_Surface_Area | 1505.88000 |
| X_logP_energy | -12.31499 |
Interaction Information
| Affinity | Ki=21.6 nM |
|---|---|
| Affinity_Assay | radioimmunoassay |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Pituitary corticotropin-inhibiting peptide: properties and use in study of corticotropin action. |
| Release_Year | 1980 |
| PMID | 6249206 |
| DOI | 10.1016/0003-9861(80)90529-9 |