PPIRE14383
Target Protein Information
| Protein_Name | Serine protease 1 |
|---|---|
| Protein_Sequence | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
| Organism_Source | Bos taurus |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | PRSS1 |
| UniProt_ID | P00760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | bevuTI-I |
|---|---|
| Peptide_Sequence | CTPSGTICSPEAPEQCCSNSCVPHQWLRIFVCA |
| Peptide_Length | 33 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](N)CS)[C@@H](C)O)[C@@H](C)O)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](C)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3568.11 |
|---|---|
| Aliphatic_Index | 59.09091 |
| Aromaticity | 0.06061 |
| Average_Rotatable_Bonds | 3.18182 |
| Charge_at_pH_7 | -1.27941 |
| Isoelectric_Point | 5.47850 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 53 |
| Number_of_Hydrogen_Bond_Donors | 52 |
| Topological_Polar_Surface_Area | 1390.98000 |
| X_logP_energy | -17.30043 |
Interaction Information
| Affinity | IC50=471 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Discovery of a Beetroot Protease Inhibitor to Identify and Classify Plant-Derived Cystine Knot Peptides. |
| Release_Year | 2020 |
| PMID | 33118348 |
| DOI | 10.1021/acs.jnatprod.0c00648 |