PPIRE14442
Target Protein Information
| Protein_Name | Bcl-2-like protein 1 |
|---|---|
| Protein_Sequence | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK |
| Organism_Source | Homo sapiens |
| Functional_Classification | Bcl-2 family proteins |
| Cellular_Localization | Mitochondrion |
| Gene_Names | BCL2L1 |
| UniProt_ID | Q07817 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | BECN1 BH3 |
|---|---|
| Peptide_Sequence | GEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDH |
| Peptide_Length | 34 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)CN)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3652.97 |
|---|---|
| Aliphatic_Index | 65.88235 |
| Aromaticity | 0.02941 |
| Average_Rotatable_Bonds | 3.70588 |
| Charge_at_pH_7 | -3.90563 |
| Isoelectric_Point | 4.13994 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 56 |
| Number_of_Hydrogen_Bond_Donors | 58 |
| Topological_Polar_Surface_Area | 1670.78000 |
| X_logP_energy | -22.19646 |
Interaction Information
| Affinity | KD=2 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2P1L |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of the Bcl-XL-Beclin 1 peptide complex: Beclin 1 is a novel BH3-only protein. |
| Release_Year | 2007 |
| PMID | 17337444 |
| DOI | 10.1074/jbc.M700492200 |