PPIRE14459
Target Protein Information
| Protein_Name | C5a anaphylatoxin chemotactic receptor 1 |
|---|---|
| Protein_Sequence | MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | C5AR1 |
| UniProt_ID | P21730 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | C5aR1-35S2 |
|---|---|
| Peptide_Sequence | MNSFNYTTPDGHDDDKDTLDLNTPVDKTSNTLRV |
| Peptide_Length | 34 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X11=O-sulfotyrosine; X14=O-sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3841.09 |
|---|---|
| Aliphatic_Index | 51.47059 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 3.64706 |
| Charge_at_pH_7 | -3.90943 |
| Isoelectric_Point | 4.08695 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 60 |
| Number_of_Hydrogen_Bond_Donors | 59 |
| Topological_Polar_Surface_Area | 1764.19000 |
| X_logP_energy | -23.98413 |
Interaction Information
| Affinity | KD=43.1 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2K3U |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of the tyrosine-sulfated C5a receptor N terminus in complex with chemotaxis inhibitory protein of Staphylococcus aureus. |
| Release_Year | 2009 |
| PMID | 19251703 |
| DOI | 10.1074/jbc.M808179200 |