PPIRE14472
Target Protein Information
| Protein_Name | Interleukin-23 subunit alpha |
|---|---|
| Protein_Sequence | MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP |
| Organism_Source | Homo sapiens |
| Functional_Classification | cytokines |
| Cellular_Localization | Extracellular |
| Gene_Names | IL23A |
| UniProt_ID | Q9NPF7 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PN-05-84 |
|---|---|
| Peptide_Sequence | FNMQCLRRMSEAGVDPNLNQEQRWAKIKSIMDDC |
| Peptide_Length | 34 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C5<->C34; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4028.62 |
|---|---|
| Aliphatic_Index | 60.29412 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 4.08824 |
| Charge_at_pH_7 | -0.12168 |
| Isoelectric_Point | 6.38885 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 58 |
| Number_of_Hydrogen_Bond_Donors | 61 |
| Topological_Polar_Surface_Area | 1753.86000 |
| X_logP_energy | -18.89109 |
Interaction Information
| Affinity | IC50=3.3 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Clustering of disulfide-rich peptides provides scaffolds for hit discovery by phage display: application to interleukin-23. |
| Release_Year | 2016 |
| PMID | 27881076 |
| DOI | 10.1186/s12859-016-1350-9 |