PPIRE14500
Target Protein Information
| Protein_Name | Pituitary adenylate cyclase-activating polypeptide type I receptor |
|---|---|
| Protein_Sequence | MARVLQLSLTALLLPVAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNITCWKPAQVGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTEDGWSEPFPHYFDACGFDDYEPESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMNDSTALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTREDPLPVPSDQHSPPFLSCVQKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Adcyap1r1 |
| UniProt_ID | P32215 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PACAP-38 |
|---|---|
| Peptide_Sequence | HSDGIFTDYSYRKQMAVKKYLAAVLGLRYRQVKNK |
| Peptide_Length | 35 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)C(C)C)C(C)C)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4148.84 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 4.05714 |
| Charge_at_pH_7 | 6.08490 |
| Isoelectric_Point | 10.59986 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 58 |
| Number_of_Hydrogen_Bond_Donors | 63 |
| Topological_Polar_Surface_Area | 1742.68000 |
| X_logP_energy | -14.73279 |
Interaction Information
| Affinity | IC50=4.9 nM |
|---|---|
| Affinity_Assay | radioligand binding (125I-PACAP-27 displacement) |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural Requirements of Maxadilan, a Non-Mammalian Potent Vasodilatory Peptide, for Interaction with the PAC-1 Receptor from Rat Brain Using a Synthetic Mini-Library |
| Release_Year | 2008 |
| PMID | None |
| DOI | 10.1007/s10989-007-9115-y |