PPIRE14569
Target Protein Information
| Protein_Name | Pro-neuropeptide Y |
|---|---|
| Protein_Sequence | MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Npy |
| UniProt_ID | P07808 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Neuropeptide Y |
|---|---|
| Peptide_Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Peptide_Length | 36 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@@H](C)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Propionyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4272.72 |
|---|---|
| Aliphatic_Index | 54.44444 |
| Aromaticity | 0.13889 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 0.08922 |
| Isoelectric_Point | 7.51555 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 60 |
| Number_of_Hydrogen_Bond_Donors | 63 |
| Topological_Polar_Surface_Area | 1826.57000 |
| X_logP_energy | -17.53562 |
Interaction Information
| Affinity | KD=0.29 nM |
|---|---|
| Affinity_Assay | equilibrium binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide YY receptor distribution and subtype in the kidney: effect on renal hemodynamics and function in rats. |
| Release_Year | 1988 |
| PMID | 9362332 |
| DOI | 10.1152/ajprenal.1997.273.4.f545 |