PPIRE14933
Target Protein Information
| Protein_Name | Endolysin |
|---|---|
| Protein_Sequence | MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL |
| Organism_Source | Enterobacteria phage T4 |
| Functional_Classification | peptidoglycan fragment |
| Cellular_Localization | Lysosome |
| Gene_Names | E |
| UniProt_ID | P00720 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cys-Lys-D-Ala-D-Ala |
|---|---|
| Peptide_Sequence | XKaa |
| Peptide_Length | 4 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CN)C(=O)O |
| Chemical_Modification | X1=S-carboxymethylcysteine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 345.40 |
|---|---|
| Aliphatic_Index | 50.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.75000 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 176.64000 |
| X_logP_energy | -2.34710 |
Interaction Information
| Affinity | KD=4.16 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 3RUN |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A carrier protein strategy yields the structure of dalbavancin. |
| Release_Year | 2012 |
| PMID | 22352468 |
| DOI | 10.1021/ja208755j |