PPIRE14952
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | GLCASQMTDTDRQAMAKSREIEAKNEGAHRVEQEKVKLLLLGAGESGKSTVFKQMKILYGAPLTDEEKRHCTPI |
| Organism_Source | Phytophthora x alni |
| Functional_Classification | serine proteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GPA1 |
| UniProt_ID | Q2Y0D1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ltc1 |
|---|---|
| Peptide_Sequence | SMWSGMWRRKLKKLRNALKKKLKGE |
| Peptide_Length | 25 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCSC)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3073.80 |
|---|---|
| Aliphatic_Index | 66.40000 |
| Aromaticity | 0.08000 |
| Average_Rotatable_Bonds | 4.56000 |
| Charge_at_pH_7 | 8.99768 |
| Isoelectric_Point | 12.32561 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 42 |
| Number_of_Hydrogen_Bond_Donors | 48 |
| Topological_Polar_Surface_Area | 1281.99000 |
| X_logP_energy | -9.12759 |
Interaction Information
| Affinity | IC50=12.68 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of natural antimicrobial agents to treat dengue infection: In vitro analysis of latarcin peptide activity against dengue virus. |
| Release_Year | 2014 |
| PMID | 24885331 |
| DOI | 10.1186/1471-2180-14-140 |