PPIRE14966
Target Protein Information
| Protein_Name | CHRNA7-FAM7A fusion protein |
|---|---|
| Protein_Sequence | MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA |
| Organism_Source | Homo sapiens |
| Functional_Classification | ligand-gated ion channel |
| Cellular_Localization | Plasma membrane |
| Gene_Names | CHRFAM7A |
| UniProt_ID | Q494W8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MARCKS ED peptide |
|---|---|
| Peptide_Sequence | KKKKKRFSFKKSFKLSGFSFKKNK |
| Peptide_Length | 24 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Myristoylation |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2952.63 |
|---|---|
| Aliphatic_Index | 16.25000 |
| Aromaticity | 0.20833 |
| Average_Rotatable_Bonds | 4.70833 |
| Charge_at_pH_7 | 11.99474 |
| Isoelectric_Point | 12.26265 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 42 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1204.75000 |
| X_logP_energy | -10.03343 |
Interaction Information
| Affinity | IC50=16 nM |
|---|---|
| Affinity_Assay | two-electrode voltage-clamp dose-response |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Inhibition of native and recombinant nicotinic acetylcholine receptors by the myristoylated alanine-rich C kinase substrate peptide. |
| Release_Year | 2008 |
| PMID | 18812491 |
| DOI | 10.1124/jpet.108.144758 |