PPIRE15055
Target Protein Information
| Protein_Name | Papain |
|---|---|
| Protein_Sequence | MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
| Organism_Source | Carica papaya |
| Functional_Classification | cysteine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P00784 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Mns-Gly-Val-Glu-Leu-Gly |
|---|---|
| Peptide_Sequence | XGVELG |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)CNC(=O)CN)C(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | X1=6-(N-methylanilino)-2-naphthalenesulfonyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Mansyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 530.58 |
|---|---|
| Aliphatic_Index | 113.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.83333 |
| Charge_at_pH_7 | -1.00024 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 8 |
| Number_of_Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 246.12000 |
| X_logP_energy | -2.71660 |
Interaction Information
| Affinity | KD=0.073 mM |
|---|---|
| Affinity_Assay | stopped-flow fluorescence spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Kinetics of the action of papain on fluorescent peptide substrates. |
| Release_Year | 1976 |
| PMID | 1276132 |
| DOI | 10.1021/bi00655a025 |