PPIRE15110
Target Protein Information
| Protein_Name | Cholera enterotoxin subunit A |
|---|---|
| Protein_Sequence | MVKIIFVFFIFLSSFSYANDDKLYRADSRPPDEIKQSGGLMPRGQSEYFDRGTQMNINLYDHARGTQTGFVRHDDGYVSTSISLRSAHLVGQTILSGHSTYYIYVIATAPNMFNVNDVLGAYSPHPDEQEVSALGGIPYSQIYGWYRVHFGVLDEQLHRNRGYRDRYYSNLDIAPAADGYGLAGFPPEHRAWREEPWIHHAPPGCGNAPRSSMSNTCDEKTQSLGVKFLDEYQSKVKRQIFSGYQSDIDTHNRIKDEL |
| Organism_Source | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
| Functional_Classification | AB5 toxins |
| Cellular_Localization | extracellular |
| Gene_Names | ctxA |
| UniProt_ID | P01555 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Minimal epitope peptide |
|---|---|
| Peptide_Sequence | VPGSQHIDS |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 938.99 |
|---|---|
| Aliphatic_Index | 75.55556 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.11111 |
| Charge_at_pH_7 | -0.91066 |
| Isoelectric_Point | 5.29226 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 436.86000 |
| X_logP_energy | -6.19300 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of an anti-cholera toxin antibody Fab in complex with an epitope-derived D-peptide: a case of polyspecific recognition. |
| Release_Year | 2007 |
| PMID | 17712773 |
| DOI | 10.1002/jmr.838 |