PPIRE15155
Target Protein Information
| Protein_Name | Platelet factor 4 |
|---|---|
| Protein_Sequence | MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| Organism_Source | Homo sapiens |
| Functional_Classification | chemokine |
| Cellular_Localization | Extracellular |
| Gene_Names | PF4 |
| UniProt_ID | P02776 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SPa |
|---|---|
| Peptide_Sequence | GGGGSXDYXGGGG |
| Peptide_Length | 13 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | X6=O-sulfotyrosine; X8=O-sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 953.88 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 2.30769 |
| Charge_at_pH_7 | -1.00242 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 490.28000 |
| X_logP_energy | -11.05480 |
Interaction Information
| Affinity | KD=5.27 mM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Heparin-mimetic sulfated peptides with modulated affinities for heparin-binding peptides and growth factors |
| Release_Year | 2007 |
| PMID | 17916399 |
| DOI | 10.1016/j.peptides.2007.08.010 |