PPIRE15163
Target Protein Information
| Protein_Name | Platelet factor 4 |
|---|---|
| Protein_Sequence | MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES |
| Organism_Source | Homo sapiens |
| Functional_Classification | chemokine |
| Cellular_Localization | Extracellular |
| Gene_Names | PF4 |
| UniProt_ID | P02776 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SPc |
|---|---|
| Peptide_Sequence | GGGGXXGGXDXG |
| Peptide_Length | 12 |
| Peptide_SMILES | NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | X5=O-sulfotyrosine; X6=O-sulfotyrosine; X9=O-sulfotyrosine; X11=O-sulfotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 760.67 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.08333 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 420.72000 |
| X_logP_energy | -10.84880 |
Interaction Information
| Affinity | KD=55.3 mM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Heparin-mimetic sulfated peptides with modulated affinities for heparin-binding peptides and growth factors |
| Release_Year | 2007 |
| PMID | 17916399 |
| DOI | 10.1016/j.peptides.2007.08.010 |