PPIRE15323
Target Protein Information
| Protein_Name | Exendin-4 |
|---|---|
| Protein_Sequence | MKIILWLCVFGLFLATLFPISWQMPVESGLSSEDSASSESFASKIKRHGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSG |
| Organism_Source | Heloderma suspectum |
| Functional_Classification | peptide hormones |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P26349 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | shuf (R-K fix) 2 |
|---|---|
| Peptide_Sequence | RWFKIQMQIRRWKNKK |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2246.75 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.18750 |
| Average_Rotatable_Bonds | 5.00000 |
| Charge_at_pH_7 | 6.99679 |
| Isoelectric_Point | 12.82564 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 28 |
| Number_of_Hydrogen_Bond_Donors | 35 |
| Topological_Polar_Surface_Area | 950.45000 |
| X_logP_energy | -5.08149 |
Interaction Information
| Affinity | KD=21.4 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The role of intermolecular interactions with penetratin and its analogue on the enhancement of absorption of nasal therapeutic peptides |
| Release_Year | 2010 |
| PMID | 20060451 |
| DOI | 10.1016/j.ijpharm.2009.12.060 |