PPIRE15332
Target Protein Information
| Protein_Name | Apolipoprotein C-III |
|---|---|
| Protein_Sequence | MQPRVLLVAALLSLLASARASEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA |
| Organism_Source | Macaca fascicularis |
| Functional_Classification | complement component |
| Cellular_Localization | Extracellular |
| Gene_Names | APOC3 |
| UniProt_ID | P18659 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Compstatin |
|---|---|
| Peptide_Sequence | ICVVQDWGHHRCT |
| Peptide_Length | 13 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)O)[C@@H](C)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<-->C12; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1553.78 |
|---|---|
| Aliphatic_Index | 74.61538 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 3.61538 |
| Charge_at_pH_7 | 0.05630 |
| Isoelectric_Point | 7.41949 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 22 |
| Number_of_Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 648.19000 |
| X_logP_energy | -5.89513 |
Interaction Information
| Affinity | IC50=10 uM |
|---|---|
| Affinity_Assay | binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Compstatin a peptide inhibitor of complement exhibits species-specific binding to complement component C3 |
| Release_Year | 2003 |
| PMID | 12431389 |
| DOI | 10.1016/s0161-5890(02)00212-2 |