PPIRE15404
Target Protein Information
| Protein_Name | Cysteine-rich secretory protein 2 |
|---|---|
| Protein_Sequence | MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY |
| Organism_Source | Homo sapiens |
| Functional_Classification | CRISP superfamily |
| Cellular_Localization | Extracellular |
| Gene_Names | CRISP2 |
| UniProt_ID | P16562 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | tpx-1-#3 |
|---|---|
| Peptide_Sequence | AGCEHELLKEKCKAT |
| Peptide_Length | 15 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)CNC(=O)[C@H](C)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | C3=Acm; C12=Acm |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1659.94 |
|---|---|
| Aliphatic_Index | 65.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.93333 |
| Charge_at_pH_7 | -0.03062 |
| Isoelectric_Point | 7.25515 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 709.59000 |
| X_logP_energy | -6.86350 |
Interaction Information
| Affinity | IC50=200 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and application of peptide immunogens related to the sperm tail protein tpx-1 a member of the CRISP superfamily of proteins |
| Release_Year | 2001 |
| PMID | 11168883 |
| DOI | 10.1034/j.1399-3011.2001.00779.x |