PPIRE15484
Target Protein Information
| Protein_Name | Ig gamma-2A chain C region A allele |
|---|---|
| Protein_Sequence | AKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | monoclonal antibody |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg |
| UniProt_ID | P01863 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Y139F |
|---|---|
| Peptide_Sequence | RGTGSFNRSSFES |
| Peptide_Length | 13 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)CNC(=O)[C@@H](N)CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1431.48 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.15385 |
| Average_Rotatable_Bonds | 3.61538 |
| Charge_at_pH_7 | 0.99975 |
| Isoelectric_Point | 10.39777 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 23 |
| Number_of_Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 717.86000 |
| X_logP_energy | -12.41916 |
Interaction Information
| Affinity | KD=0.04 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Determination of Kinetic Constants for the Interaction between a Monoclonal Antibody and Peptides Using Surface Plasmon Resonance |
| Release_Year | 1992 |
| PMID | 1627568 |
| DOI | 10.1021/bi00142a019 |