PPIRE15485
Target Protein Information
| Protein_Name | Oxytocin-neurophysin 1 |
|---|---|
| Protein_Sequence | MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH |
| Organism_Source | Bos taurus |
| Functional_Classification | carrier proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | OXT |
| UniProt_ID | P01175 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Leu-PheNH2 |
|---|---|
| Peptide_Sequence | LF |
| Peptide_Length | 2 |
| Peptide_SMILES | CC(C)C[C@H](N)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 278.35 |
|---|---|
| Aliphatic_Index | 195.00000 |
| Aromaticity | 0.50000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 3 |
| Number_of_Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 92.42000 |
| X_logP_energy | 1.17190 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Use of perdeuterated peptides in NMR studies of neurophysin-hormone interaction: demonstration of peptide-specific changes in neurophysin resonances |
| Release_Year | 1985 |
| PMID | 4004858 |
| DOI | 10.1016/0006-291x(85)91069-1 |