PPIRE15634
Target Protein Information
| Protein_Name | Ribonuclease pancreatic |
|---|---|
| Protein_Sequence | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Organism_Source | Bos taurus |
| Functional_Classification | ribonucleases |
| Cellular_Localization | Extracellular |
| Gene_Names | RNASE1 |
| UniProt_ID | P61823 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LB2 |
|---|---|
| Peptide_Sequence | CSGSGKETAWAIFVRQHMDS |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H](N)CS)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2210.47 |
|---|---|
| Aliphatic_Index | 44.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 0.02884 |
| Isoelectric_Point | 7.36006 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 33 |
| Number_of_Hydrogen_Bond_Donors | 35 |
| Topological_Polar_Surface_Area | 947.22000 |
| X_logP_energy | -11.41543 |
Interaction Information
| Affinity | KD=0.09 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Real-Time Surface Plasmon Resonance Imaging Measurements for the Multiplexed Determination of Protein Adsorption/Desorption Kinetics and Surface Enzymatic Reactions on Peptide Microarrays |
| Release_Year | 2004 |
| PMID | 15456285 |
| DOI | 10.1021/ac0494275 |