PPIRE15664
Target Protein Information
| Protein_Name | Streptavidin |
|---|---|
| Protein_Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Organism_Source | Streptomyces avidinii |
| Functional_Classification | avidin family proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P22629 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Linker-free heterodimer peptide (streptavidin) |
|---|---|
| Peptide_Sequence | WSHPQFEKDYPHPQ |
| Peptide_Length | 14 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1795.93 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.21429 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | -0.81912 |
| Isoelectric_Point | 6.49962 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 715.66000 |
| X_logP_energy | -4.94230 |
Interaction Information
| Affinity | KD=9.5 mM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conversion of Low-Affinity Peptides to High-Affinity Peptide Binders by Using a b-Hairpin Scaffold-Assisted Approach |
| Release_Year | 2014 |
| PMID | 25371172 |
| DOI | 10.1002/cbic.201402450 |