PPIRE15774
Target Protein Information
| Protein_Name | Killer cell lectin-like receptor 3 |
|---|---|
| Protein_Sequence | MSEPEVTYSTVRLHKSSGLQKLVRHEETQGPREVGNRKCSAPWQLIVKALGILCFLLLVTVAVLAVKIFQYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD |
| Organism_Source | Mus musculus |
| Functional_Classification | C type lectin like receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Klra3 |
| UniProt_ID | Q64329 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VSV |
|---|---|
| Peptide_Sequence | RGYVYQGL |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 955.08 |
|---|---|
| Aliphatic_Index | 85.00000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 0.99628 |
| Isoelectric_Point | 9.17163 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 412.47000 |
| X_logP_energy | -2.81783 |
Interaction Information
| Affinity | KD=12 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | 2VAA |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Dynamic allostery controls the peptide sensitivity of the Ly49C natural killer receptor |
| Release_Year | 2021 |
| PMID | 33891944 |
| DOI | 10.1016/j.jbc.2021.100686 |