PPIRE15834
Target Protein Information
| Protein_Name | Regulator of G-protein signaling 4 |
|---|---|
| Protein_Sequence | MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA |
| Organism_Source | Homo sapiens |
| Functional_Classification | GTPase activating proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | RGS4 |
| UniProt_ID | P49798 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P17 |
|---|---|
| Peptide_Sequence | VRHVAVEVGGVVVVVG |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)O)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1574.89 |
|---|---|
| Aliphatic_Index | 169.37500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.06250 |
| Charge_at_pH_7 | 0.09067 |
| Isoelectric_Point | 7.55131 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 627.70000 |
| X_logP_energy | -4.41773 |
Interaction Information
| Affinity | IC50=55 uM |
|---|---|
| Affinity_Assay | single-turnover GTPase assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of Peptides That Inhibit Regulator of G Protein Signaling 4 Function |
| Release_Year | 2008 |
| PMID | 18547979 |
| DOI | 10.1159/000138387 |