PPIRE15973
Target Protein Information
| Protein_Name | Dual endothelin-1/VEGF signal peptide receptor |
|---|---|
| Protein_Sequence | MTMFKGSNEMKSRWNWGSITCIICFTCVGSQLSMSSSKASNFSGPLQLYQRELEIFIVLTDVPNYRLIKENSHLHTTIVDQGRTV |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin ligases |
| Cellular_Localization | Nucleus |
| Gene_Names | FBXW7-AS1 |
| UniProt_ID | B0L3A2 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | qGlu-peptide |
|---|---|
| Peptide_Sequence | EEEEAQVRKENQW |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | fluorescein |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1674.74 |
|---|---|
| Aliphatic_Index | 30.00000 |
| Aromaticity | 0.07692 |
| Average_Rotatable_Bonds | 4.53846 |
| Charge_at_pH_7 | -2.99344 |
| Isoelectric_Point | 4.02152 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 24 |
| Number_of_Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 832.00000 |
| X_logP_energy | -8.26153 |
Interaction Information
| Affinity | KD=56 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 2OVP |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rational redesign of a cation-pai-pai stacking at cardiovascular Fbw7-Skp1 complex interface and its application for deriving self-inhibitory peptides to disrupt the complex interaction |
| Release_Year | 2017 |
| PMID | 28952040 |
| DOI | 10.1007/s00894-017-3456-z |