PPIRE16118
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MIKKPEFGLMQPPKKRVRQELSEEQKQEIKEAFDLFDTNKTGSIDYHELKVAMRALGFDVKKPEILELMNEYDREGNGYIGFDDFLDIMTEKIKNRDPVEEILKAFKVFDEDNSGKISLRNLKRVAKELGENLSDDELQAMIDEFDKDQDGEISEQEFLNIMKQTSIY |
| Organism_Source | Euplotoides octocarinatus |
| Functional_Classification | EF hand proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | centrin |
| UniProt_ID | Q9XZV2 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | XPC peptide |
|---|---|
| Peptide_Sequence | RKLRERILLGKALLKWNGLARK |
| Peptide_Length | 22 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2633.27 |
|---|---|
| Aliphatic_Index | 133.18182 |
| Aromaticity | 0.04545 |
| Average_Rotatable_Bonds | 4.36364 |
| Charge_at_pH_7 | 6.99857 |
| Isoelectric_Point | 12.53170 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 33 |
| Number_of_Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1122.28000 |
| X_logP_energy | -6.76232 |
Interaction Information
| Affinity | KD=0.17 uM |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Modulation of XPC peptide on binding Tb3+ to Euplotes octocarinatus centrin |
| Release_Year | 2017 |
| PMID | 29114686 |
| DOI | 10.1039/c7mt00263g |