PPIRE16125
Target Protein Information
| Protein_Name | Protein S100-B |
|---|---|
| Protein_Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE |
| Organism_Source | Homo sapiens |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100B |
| UniProt_ID | P04271 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53 peptide |
|---|---|
| Peptide_Sequence | YSHLKSKKGQSTSRHKKLMFKTE |
| Peptide_Length | 23 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2750.21 |
|---|---|
| Aliphatic_Index | 33.91304 |
| Aromaticity | 0.08696 |
| Average_Rotatable_Bonds | 4.34783 |
| Charge_at_pH_7 | 6.17895 |
| Isoelectric_Point | 11.11770 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 43 |
| Number_of_Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1200.90000 |
| X_logP_energy | -13.43843 |
Interaction Information
| Affinity | KD=20 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and Thermodynamic Characterization of the Recognition of the S100-Binding Peptides TRTK12 and p53 by Calmodulin |
| Release_Year | 2014 |
| PMID | 24947426 |
| DOI | 10.1002/pro.2506 |