PPIRE16155
Target Protein Information
| Protein_Name | Polyubiquitin-B |
|---|---|
| Protein_Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin |
| Cellular_Localization | Cytoplasm |
| Gene_Names | UBB |
| UniProt_ID | P0CG47 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DPDELRFNAIAL-NH2 |
|---|---|
| Peptide_Sequence | DPDELRFNAIAL |
| Peptide_Length | 12 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1373.53 |
|---|---|
| Aliphatic_Index | 114.16667 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 3.58333 |
| Charge_at_pH_7 | -1.99935 |
| Isoelectric_Point | 3.87601 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 19 |
| Topological_Polar_Surface_Area | 591.52000 |
| X_logP_energy | -4.38903 |
Interaction Information
| Affinity | KD=10 mM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Ubiquitin Binds to a Short Peptide Segment of Hydrolase UCH-L3: A Study by FCS RIfS ITC and NMR |
| Release_Year | 2007 |
| PMID | 17211910 |
| DOI | 10.1002/cbic.200600254 |