PPIRE16193
Target Protein Information
| Protein_Name | Ribonuclease pancreatic |
|---|---|
| Protein_Sequence | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Organism_Source | Bos taurus |
| Functional_Classification | endoribonucleases |
| Cellular_Localization | Extracellular |
| Gene_Names | RNASE1 |
| UniProt_ID | P61823 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S16 |
|---|---|
| Peptide_Sequence | KETAAAKFERQHLDSG |
| Peptide_Length | 16 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1787.95 |
|---|---|
| Aliphatic_Index | 43.12500 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.87500 |
| Charge_at_pH_7 | 0.09230 |
| Isoelectric_Point | 7.54974 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 29 |
| Topological_Polar_Surface_Area | 837.89000 |
| X_logP_energy | -10.01983 |
Interaction Information
| Affinity | KD=1.25 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and thermodynamic consequences of introducing u-aminoisobutyric acid in the S peptide of ribonuclease S |
| Release_Year | 2000 |
| PMID | 11112508 |
| DOI | 10.1093/protein/13.10.697 |