PPIRE16294
Target Protein Information
| Protein_Name | Capsid protein |
|---|---|
| Protein_Sequence | MDVNASRALANVYDLPDDFFPQIDDLVRDAKDALEPYWKAETIKKHVLIATHFVDLIEDFWQTTQGMSQIADALRAVIPPTTVPVPEGFLITHSEAEEIPLNDLFSNQEERIVNFQPDYPITARIHTHLRVYTKLNEQALDKARRLLWWHYNCLLWGEATVTNYISRLRTWLSTPEKYRGKDAPTIEAITRPIQVAQGGRNQTKGTRKPRGLEPRRRKVKTTVVYGRRRSKSRGRRSSPSQRAGSPLPRNRGNQTRSPSPRE |
| Organism_Source | Heron hepatitis B virus |
| Functional_Classification | capsid proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | C |
| UniProt_ID | P0C6K0 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P2 |
|---|---|
| Peptide_Sequence | GSLLGRMKGA |
| Peptide_Length | 10 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 989.20 |
|---|---|
| Aliphatic_Index | 88.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 433.37000 |
| X_logP_energy | -5.09453 |
Interaction Information
| Affinity | KD=74 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conformational Plasticity of Hepatitis B Core Protein Spikes Promotes Peptide Binding Independent of the Secretion Phenotype |
| Release_Year | 2021 |
| PMID | 33946808 |
| DOI | 10.3390/microorganisms9050956 |