PPIRE16379
Target Protein Information
| Protein_Name | Alpha-2-HS-glycoprotein |
|---|---|
| Protein_Sequence | MKSFVLLFCLAQLWGCHSIPLDPVAGYKEPACDDPDTEQAALAAVDYINKHLPRGYKHTLNQIDSVKVWPRRPTGEVYDIEIDTLETTCHVLDPTPLANCSVRQQTQHAVEGDCDIHVLKQDGQFSVLFTKCDSSPDSAEDVRKLCPDCPLLAPLNDSRVVHAVEVALATFNAESNGSYLQLVEISRAQFVPLPVSVSVEFAVAATDCIAKEVVDPTKCNLLAEKQYGFCKGSVIQKALGGEDVRVTCTLFQTQPVIPQPQPDGAEAEAPSAVPDAAGPTPSAAGPPVASVVVGPSVVAVPLPLHRAHYDLRHTFSGVASVESSSGEAFHVGKTPIVGQPSIPGGPVRLCPGRIRYFKI |
| Organism_Source | Bos taurus |
| Functional_Classification | Accessory factors acute phase glycoproteins |
| Cellular_Localization | Extracellular |
| Gene_Names | AHSG |
| UniProt_ID | P12763 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Odorranalectin |
|---|---|
| Peptide_Sequence | YASPKCFRYPNGVLACT |
| Peptide_Length | 17 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C6<-->C16; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1890.21 |
|---|---|
| Aliphatic_Index | 51.76471 |
| Aromaticity | 0.17647 |
| Average_Rotatable_Bonds | 3.17647 |
| Charge_at_pH_7 | 1.87204 |
| Isoelectric_Point | 8.77185 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 27 |
| Number_of_Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 723.27000 |
| X_logP_energy | -6.81953 |
Interaction Information
| Affinity | KD=0.21 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Odorranalectin Is a Small Peptide Lectin with Potential for Drug Delivery and Targeting |
| Release_Year | 2008 |
| PMID | 18584053 |
| DOI | 10.1371/journal.pone.0002381 |