PPIRE16411
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide 3 |
|---|---|
| Peptide_Sequence | TKDTNNNLC |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | C9=5-(iodoacetamido)fluorescein |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1022.10 |
|---|---|
| Aliphatic_Index | 43.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.77778 |
| Charge_at_pH_7 | -0.06384 |
| Isoelectric_Point | 6.16057 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 529.17000 |
| X_logP_energy | -8.75590 |
Interaction Information
| Affinity | KD=0.05 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Preparation and Application of a Fluorescein-Labeled Peptide for Determining the Affinity Constant of a Monoclonal Antibody-Hapten Complex by Fluorescence Polarization |
| Release_Year | 1991 |
| PMID | 1776694 |
| DOI | 10.1016/0003-2697(91)90488-f |