PPIRE16474
Target Protein Information
| Protein_Name | Phospholipid scramblase 3 |
|---|---|
| Protein_Sequence | MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS |
| Organism_Source | Homo sapiens |
| Functional_Classification | Phospholipid scramblases |
| Cellular_Localization | Plasma membrane |
| Gene_Names | PLSCR3 |
| UniProt_ID | Q9NRY6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide III |
|---|---|
| Peptide_Sequence | DADDFGLQFPLD |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1352.42 |
|---|---|
| Aliphatic_Index | 73.33333 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.41667 |
| Charge_at_pH_7 | -4.00023 |
| Isoelectric_Point | 3.22803 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 566.92000 |
| X_logP_energy | -4.36950 |
Interaction Information
| Affinity | KD=2793.3 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Calcium binding studies of peptides of human phospholipid scramblases 1 to 4 suggest that scramblases are new class of calcium binding proteins in the cell |
| Release_Year | 2009 |
| PMID | 19540310 |
| DOI | 10.1016/j.bbagen.2009.06.008 |