PPIRE16536
Target Protein Information
| Protein_Name | Profilin-1 |
|---|---|
| Protein_Sequence | MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL |
| Organism_Source | Betula pendula |
| Functional_Classification | actin binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | BETVII |
| UniProt_ID | P25816 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | deca-L-proline (P10) |
|---|---|
| Peptide_Sequence | PPPPPPPPPP |
| Peptide_Length | 10 |
| Peptide_SMILES | O=C(O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1 |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 989.18 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 1.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 2 |
| Topological_Polar_Surface_Area | 232.12000 |
| X_logP_energy | -0.25800 |
Interaction Information
| Affinity | KD=0.2 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Birch pollen profilin: structural organization and interaction with poly-(L-proline) peptides as revealed by NMR |
| Release_Year | 1997 |
| PMID | 9271223 |
| DOI | 10.1016/S0014-5793(97)00719-9 |